PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G015100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 318aa    MW: 35259.6 Da    PI: 8.5854
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G015100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-161462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEd +l++ ++++G+g +W + +++ g++R++k+c++rw++yl
  Sevir.7G015100.1.p 14 KGPWSPEEDAKLKEFIEKHGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                        79*********************************************97 PP

2Myb_DNA-binding35.13.1e-1169111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g +T+ Ed  +    +  G++ W+ Ia+ ++ gRt++++k++w++
  Sevir.7G015100.1.p  69 GEFTEHEDRVICSMYASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                         78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.884966IPR017930Myb domain
SuperFamilySSF466891.3E-2711109IPR009057Homeodomain-like
SMARTSM007179.4E-131364IPR001005SANT/Myb domain
PfamPF002499.2E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-241569IPR009057Homeodomain-like
CDDcd001674.68E-101662No hitNo description
PROSITE profilePS5129415.81867117IPR017930Myb domain
SMARTSM007175.8E-1167115IPR001005SANT/Myb domain
PfamPF002492.6E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009785Biological Processblue light signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDAKLKEFIE KHGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FTEHEDRVIC SMYASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLLGS  120
TATPPPHRAP RHHHRPLNLM LQHTSPSLPQ PTYNSFFSGA GALHNPISIP ALNLPPPQDY  180
MLNSSVVMPN APSLLQGHGA TQQQFHQHVV KEESGSMIVF GSDQQSCSSS DGAHSQPQFG  240
HGKELSFDGY FGYNNGSIEH DHRLLQLQDH HQAQAPVEYN YEEIKQLLMS STTGNLHGHG  300
QDGGMEGFGS QGKVTMM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0962051e-130FP096205.1 Phyllostachys edulis cDNA clone: bphylf043l07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975125.10.0PREDICTED: transcription factor RAX2-like
TrEMBLK3Y8T50.0K3Y8T5_SETIT; Uncharacterized protein
STRINGSi010627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-76myb domain protein 36